PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_41513_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 189aa    MW: 21141.1 Da    PI: 9.1811
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_41513_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.85.2e-221053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     ++++  rqvtfskRrng++KKA+EL +LC+a+va+++fs+ gk
  Neem_41513_f_1 10 MVKDSNSRQVTFSKRRNGLFKKANELATLCAAQVAIVVFSPGGK 53
                    5789999**********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.59161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.11E-28176IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-34160IPR002100Transcription factor, MADS-box
CDDcd002656.42E-34271No hitNo description
PRINTSPR004041.4E-20323IPR002100Transcription factor, MADS-box
PfamPF003196.9E-251157IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MGRRKIEMKM VKDSNSRQVT FSKRRNGLFK KANELATLCA AQVAIVVFSP GGKPFSFGHP  60
SVDSVAQRFL NQDSGKNPAE AYDHVDPRQQ ARVEKLSQQL TDLLQELHVE KKRGEALDKD  120
IKANAMFRNK KSINDLNLDE LLKMKASLEV LRENLKGLVN EMEASASLLL LKQGTGEDDD  180
DQQLGSCQI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006468192.11e-82PREDICTED: agamous-like MADS-box protein AGL29
SwissprotO647033e-51AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLA0A067GET81e-82A0A067GET8_CITSI; Uncharacterized protein
STRINGPOPTR_0004s13600.12e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-52AGAMOUS-like 29